PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_6581_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 105aa    MW: 11947.8 Da    PI: 8.9888
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_6581_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.7e-183178148
                                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                        +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  cra_locus_6581_iso_2_len_410_ver_3 31 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 78
                                        79******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-252281IPR009057Homeodomain-like
PROSITE profilePS5129425.0752682IPR017930Myb domain
SMARTSM007172.4E-143080IPR001005SANT/Myb domain
PfamPF002493.8E-173178IPR001005SANT/Myb domain
SuperFamilySSF466893.22E-2232105IPR009057Homeodomain-like
CDDcd001673.23E-123378No hitNo description
Gene3DG3DSA:1.10.10.604.5E-782105IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
KSTHKVEEAE EKEIIINMGR PPCCDKVGIK KGPWTPEEDI ILVSYIQEHG PGNWRSVPTN  60
TGLLRCSKSC RLRWTNYLRP GIKRGNFTPH EEGMIIHLQA LLGNK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006484863.11e-62PREDICTED: myb-related protein 306
RefseqXP_012465520.11e-62PREDICTED: myb-related protein 306-like
SwissprotP813921e-59MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D2VHT39e-63A0A0D2VHT3_G
STRINGPOPTR_0013s06390.13e-61(Populus trichocarpa)